Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 1B (Htr1b)

This Recombinant Mouse 5-hydroxytryptamine receptor 1B (Htr1b) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

P28334

Expression Region

1-386

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQGIQCAPPPPAASQTGVPLTNLSHNCSADGYIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPP FFWRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLTRAQLITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI NPIIYTMSNEDFKQAFHKLIRFKCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gilvetmab
BA6158-5 5 mg

Gilvetmab

Sign In for Pricing
View Details
FES 3'UTR GFP Stable Cell Line
TU057895 1.0 mL

FES 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PEnCMV-EGFP-Cnbp (mouse) -SV40-Neo
BZ43401 1 Vial

PEnCMV-EGFP-Cnbp (mouse) -SV40-Neo

Sign In for Pricing
View Details
Lentiviral mouse Mier2 shRNA (UAS) - Lentiviral mouse Mier2 shRNA (UAS, iRFP) (25)
GTR15241970 1 Vial

Lentiviral mouse Mier2 shRNA (UAS) - Lentiviral mouse Mier2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
TAS2R41, NT (TAS2R41, Taste receptor type 2 member 41, Taste receptor type 2 member 59) (FITC)
MBS6353724-01 0.2 mL

TAS2R41, NT (TAS2R41, Taste receptor type 2 member 41, Taste receptor type 2 member 59) (FITC)

Sign In for Pricing
View Details
TAS2R41, NT (TAS2R41, Taste receptor type 2 member 41, Taste receptor type 2 member 59) (FITC)
MBS6353724-02 5x 0.2 mL

TAS2R41, NT (TAS2R41, Taste receptor type 2 member 41, Taste receptor type 2 member 59) (FITC)

Sign In for Pricing
View Details