Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Cat 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

Q588Y6

Expression Region

1-389

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEETNTHCAPPPPAGSQTGVSQANLSSAPPNCSTEGYIYQDSIALPWKVLLILVLALFTL ATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVV CDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISIS LPPFFWRQAKAEEEVSDCRVNTDHMLYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILK QTPNRTGKRLTRAQLITDSPGSTSSVTSVNSRAPDVPSESGSPVYVNQVKVRVSDALLEK KKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLN SLINPIIYTMSNEDFKQAFHKLIRFKCTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDF4 polyclonal antibody
BS76316-01 50 µL

SDF4 polyclonal antibody

Sign In for Pricing
View Details
SDF4 polyclonal antibody
BS76316-02 100 µL

SDF4 polyclonal antibody

Sign In for Pricing
View Details
(2E,4E,6E,8E) -2,4,6,8-Decatetraenoic Acid Methyl-d3 Ester
421481 5 mg

(2E,4E,6E,8E) -2,4,6,8-Decatetraenoic Acid Methyl-d3 Ester

Sign In for Pricing
View Details
Recombinant Human ALDH1A2 Protein
PDEH100057-01 20 µg

Recombinant Human ALDH1A2 Protein

Sign In for Pricing
View Details
Recombinant Human ALDH1A2 Protein
PDEH100057-02 100 µg

Recombinant Human ALDH1A2 Protein

Sign In for Pricing
View Details
Anti-Transcription Factor E3 Rabbit Monoclonal Antibody
MA5495-.1 100 µL

Anti-Transcription Factor E3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details