Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Procavia capensis habessinica Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Procavia capensis habessinica Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O19054

Expression Region

1-389

Origin

Procavia capensis habessinica (Abyssinian hyrax)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPRGRPQCMLNQEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRSNRRGPRAKGAPGEGESKQPHPLTAGPLALANPPTLATSLAVDGEANGHSKL TGEKERETSEDPGTPTLQRSWPVLPSSGQSQKKGVCGASPEEEAEGEEEGSRPLSVPASP ASACGPHLQQPQGSQVLATLRGQVLLGRGVGAAGGQWWRRRAQLTREKRFTFVLTVVIGV FVLCWFPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-500 1x 500 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL
BNC740812-500 1x 500 µL

Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (139H2), CF647 conjugate, 0.1mg/mL
BNC470925-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (139H2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details