Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C56F8.12 (SPAC56F8.12)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C56F8.12 (SPAC56F8.12) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Uncharacterized protein C56F8.12

UniProt

Q10260

Expression Region

1-394

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNDSQVQLFQLYNYSVYSNGTISNFTNCYLINDEHTPIIESDGMIYNGQSCDSPVKSLA SHGAVGIVTACFCFFLIPLLLVNIAKYWKGKPPLLKRRMEFIWITLLILALAVGGFAYID VDRNLVQGAAMKIFSFTFQTALPISIAIIWHVISTYGFALYRQRIVVGKHAAHFSLDHWI FVVEYYAPIVFYVFNLMGFFLAALHPWTKVVRGDGNAATDGRFKASSVLLAIAWVFACAM FIVYSFVYKLDRRGRWVGMVIMMISILPRIVYQFLETWSFTLNASNVSVNAGLVFGLGFC PPLILAYTVCIYGWAVPSIAELEKEAIHEECRQRKRRTTISRDNSTRSTWGIGSEHDMQC LPPSYETMGPCEKEMKEETNEVEIASIESGEVRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF488A conjugate, 0.1mg/mL
BNC882427-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF488A conjugate, 0.1mg/mL
BNC881481-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF405S conjugate, 0.1mg/mL
BNC042227-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details