Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Thyrotropin-releasing hormone receptor (TRHR)

This Recombinant Chicken Thyrotropin-releasing hormone receptor (TRHR) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Thyrotropin-releasing hormone receptor, TRH-R, Thyroliberin receptor

UniProt

O93603

Expression Region

1-395

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENGTGDEQNHTGLLLSSQEFVTAEYQVVTILLVLLICGLGIVGNIMVVLVVLRTKHMRT PTNCYLVSLAVADLMVLVAAGLPNITESLYKSWVYGYVGCLCITYLQYLGINASSFSITA FTIERYIAICHPIKAQFLCTFSRAKKIIIFVWSFASVYCMLWFFLLDLNIAVYKDTTVVS CGYKVSRSYYSPIYMMDFGIFYVLPMVLATVLYGLIARILFLNPIPSDPKENSNTWKNDM AQQNKTVNSKMTNKSFNSTIASRRQVTKMLAVVVVLFAFLWMPYRTLVVVNSFLSSPFQE NWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCHLKRDKKPANYSVALNYNVIK ESDHFSSEIEDITVTNTYLSSAKTSIGDTCLSSEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-500 1x 500 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/2230R), CF405S conjugate, 0.1mg/mL
BNC042230-500 1x 500 µL

FOXA1 / HNF3A (FOXA1/2230R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), 1mg/mL
BNUM0040-50 1x 50 µL

CD35 / CR1 (E11), 1mg/mL

Sign In for Pricing
View Details