Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Odorant receptor 2a (Or2a)

This Recombinant Drosophila melanogaster Odorant receptor 2a (Or2a) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Odorant receptor 2a

UniProt

O46077

Expression Region

1-397

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKQEDFKLNTHSAVYYHWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLAR LLFTTNMAGLCENLTITITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEI SALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLI NIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWR EEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHT AMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLART QRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLRAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-500 1x 500 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF640R conjugate, 0.1mg/mL
BNC400495-500 1x 500 µL

SUMO-1 (SM1/495), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (TYR/2024R), CF405S conjugate, 0.1mg/mL
BNC042024-500 1x 500 µL

Tyrosinase (Melanoma Marker) (TYR/2024R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details