Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Bombesin receptor subtype-3 (BRS3)

This Recombinant Sheep Bombesin receptor subtype-3 (BRS3) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Bombesin receptor subtype-3, BRS-3

UniProt

O97967

Expression Region

1-399

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQRQPQSPNQTLISTTNDTESSSSVVPNDSTNKRRTGDNSPGIEALCAIYITYAVIISV GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDVTHYLAEGWLFGRIGC KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPPNAILKTCAKAGCIWIMSMIIAL PEAIFSNVYTFQDPDKNVTFKACASYPVSERLLQEIHSLLCFLVFYIIPLSIISVYYSLI ARTLYKSTLNIPTEEQRHARKQIESRKRIAKTVLVLVALFALCWLPNHLLYLYRSFTSQT YMDSSTVHLFVTIISRILAFSNSCVNPFALYWLSNTFQQHFKAQLFCCKAGRPDPTAANT PLDNLAVMGRVPGAASTQMSEISVSPFTGCSVKKEDDRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NM23-H1/NME1 antibody
ATGA0585-100 100 µL

Human NM23-H1/NME1 antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 BDM Polyclonal Antibody
MBS7161805 Inquire

Rabbit anti-Escherichia coli O157:H7 BDM Polyclonal Antibody

Sign In for Pricing
View Details
Talin (TLN, Talin-1, TLN1, ILWEQ, KIAA1027) (APC)
MBS6242497-01 0.1 mL

Talin (TLN, Talin-1, TLN1, ILWEQ, KIAA1027) (APC)

Sign In for Pricing
View Details
Talin (TLN, Talin-1, TLN1, ILWEQ, KIAA1027) (APC)
MBS6242497-02 5x 0.1 mL

Talin (TLN, Talin-1, TLN1, ILWEQ, KIAA1027) (APC)

Sign In for Pricing
View Details
PPAR gamma Polyclonal Antibody, Cy7 Conjugated
bs-0530R-Cy7 100 µL

PPAR gamma Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
C9orf95/NRK Rabbit pAb, PE-Cy7 conjugated
orb2862748 100 µL

C9orf95/NRK Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details