Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Beta-3 adrenergic receptor (Adrb3)

This Recombinant Rat Beta-3 adrenergic receptor (Adrb3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

P26255

Expression Region

1-400

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPHKNGSLAFWSDAPTLDPSAANTSGLPGVPWAAALAGALLALATVGGNLLVITAIA RTPRLQTITNVFVTSLATADLVVGLLVMPPGATLALTGHWPLGATGCELWTSVDVLCVTA SIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSATVSFAPIMSQWWRVGAD AEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLLRRELG RFPPEESPRSPSRSPSPATVGTPTASDGVPSCGRRPARLLPLGEHRALRTLGLIMGIFSL CWLPFFLANVLRALVGPSLVPSGVFIALNWLGYANSAFNPLIYCRSPDFRDAFRRLLCSY GGRGPEEPRVVTFPASPVASRQNSPLNRFDGYEGERPFPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD209 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
15496111 3x 1.0 µg

CD209 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CD85c Rabbit pAb
E2251697 100 µL

CD85c Rabbit pAb

Sign In for Pricing
View Details
TMED9 Antibody - HRP Conjugated
OACA01176-100UG 100 µg

TMED9 Antibody - HRP Conjugated

Sign In for Pricing
View Details
Beta III Tubulin (TUBB3) (NM_006086) Human Over-expression Lysate
LS010381-100ug 100 µg

Beta III Tubulin (TUBB3) (NM_006086) Human Over-expression Lysate

Sign In for Pricing
View Details
Polywire Rack Full, Delrin, Nylon, 13 mm, 72 Places, Blue - 4 un. - ABDOS
P20725B 4 Units/Pack

Polywire Rack Full, Delrin, Nylon, 13 mm, 72 Places, Blue - 4 un. - ABDOS

Sign In for Pricing
View Details
OATA01263-2MG - Goat Anti-Rabbit IgG Antibody : FITC
OATA01263-2MG 2 mg

OATA01263-2MG - Goat Anti-Rabbit IgG Antibody : FITC

Sign In for Pricing
View Details