Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Beta-3 adrenergic receptor (Adrb3)

This Recombinant Rat Beta-3 adrenergic receptor (Adrb3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

P26255

Expression Region

1-400

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPHKNGSLAFWSDAPTLDPSAANTSGLPGVPWAAALAGALLALATVGGNLLVITAIA RTPRLQTITNVFVTSLATADLVVGLLVMPPGATLALTGHWPLGATGCELWTSVDVLCVTA SIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSATVSFAPIMSQWWRVGAD AEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLLRRELG RFPPEESPRSPSRSPSPATVGTPTASDGVPSCGRRPARLLPLGEHRALRTLGLIMGIFSL CWLPFFLANVLRALVGPSLVPSGVFIALNWLGYANSAFNPLIYCRSPDFRDAFRRLLCSY GGRGPEEPRVVTFPASPVASRQNSPLNRFDGYEGERPFPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP6 (NM_001718) Human Tagged ORF Clone
RG212307 10 µg

BMP6 (NM_001718) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Rhesus Macaque IFNAR1 Protein (C-His)
MBS2557603-01 0.01 mg

Recombinant Rhesus Macaque IFNAR1 Protein (C-His)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque IFNAR1 Protein (C-His)
MBS2557603-02 0.05 mg

Recombinant Rhesus Macaque IFNAR1 Protein (C-His)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque IFNAR1 Protein (C-His)
MBS2557603-03 5x 0.05 mg

Recombinant Rhesus Macaque IFNAR1 Protein (C-His)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Hydroxyacylglutathione hydrolase (gloB)
MBS1335689-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Hydroxyacylglutathione hydrolase (gloB)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Hydroxyacylglutathione hydrolase (gloB)
MBS1335689-02 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Hydroxyacylglutathione hydrolase (gloB)

Sign In for Pricing
View Details