Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 143 (GPR143)

This Recombinant Human G-protein coupled receptor 143 (GPR143) spans the amino acid sequence from region 1-404.

Product Specifications

Product Name Alternative

G-protein coupled receptor 143, Ocular albinism type 1 protein

UniProt

P51810

Expression Region

1-404

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSP ATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSA MWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPS VSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGA VIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNP AQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVG GQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5’-Acetyl-2’,3’-isopropylidene Adenosine
TRC-A179575-5G 5 g

5’-Acetyl-2’,3’-isopropylidene Adenosine

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF594 conjugate, 0.1mg/mL
BNC940759-500 1x 500 µL

Human IgM Immunoglobulin (DA4-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wheat Germ Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW11F4-WG 10x 96 Well Plates

Wheat Germ Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
MOSPD1 Human Gene Knockout Kit (CRISPR)
KN401517 1 Kit

MOSPD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HERC6 Rabbit polyclonal Antibody
HA500594 100 µL

HERC6 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS508175 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details