Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2 adrenergic receptor (ADRB2)

This Recombinant Cat Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q9TST5

Expression Region

1-418

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNRSVFLLAPNGSHAPDQDGTQERNDAWVVGMGIVMSLIVLAIVFGNVLVITAIAR FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAQRQLQKIDKSEGRF HAQNLSQVEQDGRSGHGHRRASKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSNNSNS RTDYAGEHSGGPLGQEKDSEVLCEDPPGTENLANRQGTVPNDSIDSQGQNGSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF213 (Zinc Finger Protein 213, CR53, ZKSCAN21) (APC)
MBS6167958-01 0.1 mL

ZNF213 (Zinc Finger Protein 213, CR53, ZKSCAN21) (APC)

Sign In for Pricing
View Details
ZNF213 (Zinc Finger Protein 213, CR53, ZKSCAN21) (APC)
MBS6167958-02 5x 0.1 mL

ZNF213 (Zinc Finger Protein 213, CR53, ZKSCAN21) (APC)

Sign In for Pricing
View Details
Phosphazene base P4-t-Bu solution
sc-258013A 5 mL

Phosphazene base P4-t-Bu solution

Sign In for Pricing
View Details
NOX1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
32024126 3x 1.0µg DNA

NOX1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
PRDM5 Polyclonal Antibody
CAC15387-01 50 µg

PRDM5 Polyclonal Antibody

Sign In for Pricing
View Details
PRDM5 Polyclonal Antibody
CAC15387-02 100 µg

PRDM5 Polyclonal Antibody

Sign In for Pricing
View Details