Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2 adrenergic receptor (ADRB2)

This Recombinant Cat Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q9TST5

Expression Region

1-418

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNRSVFLLAPNGSHAPDQDGTQERNDAWVVGMGIVMSLIVLAIVFGNVLVITAIAR FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAQRQLQKIDKSEGRF HAQNLSQVEQDGRSGHGHRRASKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSNNSNS RTDYAGEHSGGPLGQEKDSEVLCEDPPGTENLANRQGTVPNDSIDSQGQNGSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal L1TD1 Antibody [Alexa Fluor 405]
NBP2-81960AF405 0.1 mL

Rabbit Polyclonal L1TD1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Rabbit Polyclonal PITPNC1 Antibody [mFluor Violet 450 SE]
NBP2-97834MFV450 0.1 mL

Rabbit Polyclonal PITPNC1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Human TNFRSF10C shRNA Plasmid
abx955794-01 150 µg

Human TNFRSF10C shRNA Plasmid

Sign In for Pricing
View Details
Human TNFRSF10C shRNA Plasmid
abx955794-02 300 µg

Human TNFRSF10C shRNA Plasmid

Sign In for Pricing
View Details
Sodium lauroyl glutamate
orb1940536-01 1 g

Sodium lauroyl glutamate

Sign In for Pricing
View Details
Sodium lauroyl glutamate
orb1940536-02 100 mg

Sodium lauroyl glutamate

Sign In for Pricing
View Details