Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2 adrenergic receptor (ADRB2)

This Recombinant Cat Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q9TST5

Expression Region

1-418

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNRSVFLLAPNGSHAPDQDGTQERNDAWVVGMGIVMSLIVLAIVFGNVLVITAIAR FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAQRQLQKIDKSEGRF HAQNLSQVEQDGRSGHGHRRASKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSNNSNS RTDYAGEHSGGPLGQEKDSEVLCEDPPGTENLANRQGTVPNDSIDSQGQNGSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NACA2 Human Over-expression Lysate
orb1355249 100 µg

NACA2 Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf132 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0212705 3x 1.0 µg

C1orf132 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Polyclonal Antibody to Hemopexin (HPX)
MBS2112195-01 0.1 mL

Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details
Polyclonal Antibody to Hemopexin (HPX)
MBS2112195-02 0.2 mL

Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details
Polyclonal Antibody to Hemopexin (HPX)
MBS2112195-03 0.5 mL

Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details
Polyclonal Antibody to Hemopexin (HPX)
MBS2112195-04 1 mL

Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details