Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Secretin receptor (Sctr)

This Recombinant Mouse Secretin receptor (Sctr) spans the amino acid sequence from region 29-447.

Product Specifications

Product Name Alternative

Secretin receptor, SCT-R

UniProt

Q5FWI2

Expression Region

29-447

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LPRLCDVRRVLLEERAECLRELSEEKKALGPKTASGCERFWDNMSCWPSSALAQTVEVPC PKFLRMFSGRNGSLFRNCTKDGWSETFPRPDLACGVNMNGSFNERRHAYLLKLKVMYTVG YSSSLAMLLVALSILCSFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFPADDVTYCD AHRAGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKCLQAFVLFGWGSPAIF VALWAVTRHFLEDFGCWDINSNASIWWVIRGPVILSIVINFIFFINILRILMRKLRTQET RGNETHHYKRLAKSTLLLIPLFGIHYIVFAFSPEGAMEVQLFFELALGSFQGLVVAVLYC FLNGELEVQKKWRQWHLQEFPLRPVALSNSFSNATNGPTHSTKAGTSEQSRSIPGANVI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Botulinum smpB Protein (aa 1-156) (strain Loch Maree / Type A3)
VAng-Lsx8778-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum smpB Protein (aa 1-156) (strain Loch Maree / Type A3)

Sign In for Pricing
View Details
SAT1 AAV Vector (Rat) (CMV)
43036106 1 µg

SAT1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Argonaute 3/eIF2C3 Recombinant Antibody, RBITC Conjugated
bsm-61315R-RBITC-01 20 µL

Argonaute 3/eIF2C3 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Argonaute 3/eIF2C3 Recombinant Antibody, RBITC Conjugated
bsm-61315R-RBITC-02 100 µL

Argonaute 3/eIF2C3 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Bovine Cytokine receptor like factor 3 (CRLF3) ELISA kit
GTR10405533 96 Well

Bovine Cytokine receptor like factor 3 (CRLF3) ELISA kit

Sign In for Pricing
View Details
Rat soluble interleukin-2 receptor, IL-2sRα ELISA Kit
SL0641Ra-01 48 Tests

Rat soluble interleukin-2 receptor, IL-2sRα ELISA Kit

Sign In for Pricing
View Details