Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Bacteroid development protein BacA (bacA)

This Recombinant Rhizobium meliloti Bacteroid development protein BacA (bacA) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Bacteroid development protein BacA

UniProt

Q08120

Expression Region

1-420

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQSFFPKPKLFFISSAVWSLLAVLAWYAGGRDIGAYLGLPPLPPGQEPVIGVSVFWSTP FLWFYIYYAVVAGLFAAFWFAYSPHRWQYWSVLGTALIIFNTYFSVQVSVAINAWYGPFY DLIQQALARTAPVTAGQLYSGMIGFSGIAFVAVTVGVLNLFFVSHYIFRWRTAMNEFYVA HWPRLRHVEGASQRVQEDTMRFSSTVERLGVGLVSSIMTLIAFLPVLFKFSEQVNVLPIV GEIPHALVWAAVFWSVFGTVFLAAVGIKLPGLEFRNQRVEAAYRKELVYGEDHEDRADPI TLAQLFDNVRRNYFRLYFHYMYFNIARIFYLQADNLFGTFVLVPAIVAGKLTLGVMNQVL NVFGQVRESFQYLVNSWTTIVELLSIYKRLKAFESVLVDEPLPEIDRQFIDAGGKEELAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human CDH6 / K-Cadherin (DS-6000a Biosimilar)
orb2828871-01 1 mg

Anti-human CDH6 / K-Cadherin (DS-6000a Biosimilar)

Sign In for Pricing
View Details
Anti-human CDH6 / K-Cadherin (DS-6000a Biosimilar)
orb2828871-02 5 mg

Anti-human CDH6 / K-Cadherin (DS-6000a Biosimilar)

Sign In for Pricing
View Details
Anti-human CDH6 / K-Cadherin (DS-6000a Biosimilar)
orb2828871-03 20 mg

Anti-human CDH6 / K-Cadherin (DS-6000a Biosimilar)

Sign In for Pricing
View Details
SAMD11 siRNA (m)
sc-153203 10 µM

SAMD11 siRNA (m)

Sign In for Pricing
View Details
SLC20A2 (Sodium-Dependent Phosphate Transporter 2, Solute Carrier Family 20 (PhosphateTtransporter), Member 2)
491893 100 µL

SLC20A2 (Sodium-Dependent Phosphate Transporter 2, Solute Carrier Family 20 (PhosphateTtransporter), Member 2)

Sign In for Pricing
View Details
FANCG Protein Vector (Human) (pPM-C-His)
PV015676 500 ng

FANCG Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details