Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Bacteroid development protein BacA (bacA)

This Recombinant Rhizobium meliloti Bacteroid development protein BacA (bacA) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Bacteroid development protein BacA

UniProt

Q08120

Expression Region

1-420

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQSFFPKPKLFFISSAVWSLLAVLAWYAGGRDIGAYLGLPPLPPGQEPVIGVSVFWSTP FLWFYIYYAVVAGLFAAFWFAYSPHRWQYWSVLGTALIIFNTYFSVQVSVAINAWYGPFY DLIQQALARTAPVTAGQLYSGMIGFSGIAFVAVTVGVLNLFFVSHYIFRWRTAMNEFYVA HWPRLRHVEGASQRVQEDTMRFSSTVERLGVGLVSSIMTLIAFLPVLFKFSEQVNVLPIV GEIPHALVWAAVFWSVFGTVFLAAVGIKLPGLEFRNQRVEAAYRKELVYGEDHEDRADPI TLAQLFDNVRRNYFRLYFHYMYFNIARIFYLQADNLFGTFVLVPAIVAGKLTLGVMNQVL NVFGQVRESFQYLVNSWTTIVELLSIYKRLKAFESVLVDEPLPEIDRQFIDAGGKEELAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP6 AAV Vector (Rat) (CMV)
45165106 1 µg

SP6 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Lentiviral human KLHL25 sgRNA gene knockout kit - Lentiviral human KLHL25 sgRNA gene knockout kit (25)
GTR15378168 1 Vial

Lentiviral human KLHL25 sgRNA gene knockout kit - Lentiviral human KLHL25 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Erwinia carotovora subsp. atroseptica Multidrug resistance protein MdtK (mdtK), partial
MBS7085086 Inquire

Recombinant Erwinia carotovora subsp. atroseptica Multidrug resistance protein MdtK (mdtK), partial

Sign In for Pricing
View Details
CDC25B, Phosphorylated (Ser187) (M-phase Inducer Phosphatase 2, Dual Specificity Phosphatase Cdc25B, CDC25HU2) (MaxLight 490)
MBS6468440-01 0.1 mL

CDC25B, Phosphorylated (Ser187) (M-phase Inducer Phosphatase 2, Dual Specificity Phosphatase Cdc25B, CDC25HU2) (MaxLight 490)

Sign In for Pricing
View Details
CDC25B, Phosphorylated (Ser187) (M-phase Inducer Phosphatase 2, Dual Specificity Phosphatase Cdc25B, CDC25HU2) (MaxLight 490)
MBS6468440-02 5x 0.1 mL

CDC25B, Phosphorylated (Ser187) (M-phase Inducer Phosphatase 2, Dual Specificity Phosphatase Cdc25B, CDC25HU2) (MaxLight 490)

Sign In for Pricing
View Details
LPA (Oleyl)
abx282337-01 5 mg

LPA (Oleyl)

Sign In for Pricing
View Details