Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cholecystokinin receptor type A (CCKAR)

This Recombinant Human Cholecystokinin receptor type A (CCKAR) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Cholecystokinin receptor type A, CCK-A receptor, CCK-AR, Cholecystokinin-1 receptor, CCK1-R

UniProt

P32238

Expression Region

1-428

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH MSASVPPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM183A activation kit by CRISPRa
GA118467 1 Kit

Human FAM183A activation kit by CRISPRa

Sign In for Pricing
View Details
DGKA (C-term) Mouse Monoclonal Antibody [Clone ID: M6]
AM33028PU-N 100 µg

DGKA (C-term) Mouse Monoclonal Antibody [Clone ID: M6]

Sign In for Pricing
View Details
Smad4 Mouse Gene Knockout Kit (CRISPR)
KN516273 1 Kit

Smad4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562911 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
IL-1 beta Recombinant Rabbit monoclonal Antibody
HA723965 100 µL

IL-1 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TMEM168 (C-term) Rabbit Polyclonal Antibody
AP54274PU-N 400 µL

TMEM168 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details