Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Labrus ossifagus Alpha-2 adrenergic receptor

This Recombinant Labrus ossifagus Alpha-2 adrenergic receptor spans the amino acid sequence from region 1-432.

Product Specifications

Product Name Alternative

Alpha-2 adrenergic receptor, Alpha-2 adrenoreceptor, Alpha-2 adrenoceptor

UniProt

Q91081

Expression Region

1-432

Origin

Labrus ossifagus (Cuckoo wrasse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNATGMDAFTAIHLNASWSADSGYSLAAIASIAALVSFLILFTVVGNILVVIAVLTS RALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKVWCGIYLALDVLFCTSSI VHLCAISLDRYWSVTQAVEYNLKRTPKRVKCIIVIVWLISAFISSPPLLSIDSNNYISSQ PQCMLNDDTWYILSSSMASFFAPCLIMILVYIRIYQVAKTRTRSMSGKEPRPDGVTQTEN GLNKANSPCHGDRENGHCQCPPTPSQRTVTIGQQTDDADMDESFSSEGKGHKPQRQDSQR AKRPGLKKSSISKQSARISRVSNKSVDLFASRRKRRRSSIAEKKVSQAREKRFTFVLAVV MGVFVVCWFPFFFSYSLHAVCRDYCKIPDTLFKFFWIGYCNSSLNPAIYTIFNRDFRRAF QKILCKSWKKSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ASTL activation kit by CRISPRa
GA118421 1 Kit

Human ASTL activation kit by CRISPRa

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF740 conjugate, 0.1mg/mL
BNC743527-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CytoTrace™ Ultra Green
21800-AAT 1 mg

CytoTrace™ Ultra Green

Sign In for Pricing
View Details
Sodium Iodide Symporter (SLC5A5) (NM_000453) Human Over-expression Lysate
LC400159 20 µg

Sodium Iodide Symporter (SLC5A5) (NM_000453) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-
I-1102-1 1 mg

Ferritin Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-

Sign In for Pricing
View Details
RPS12 (NM_001016) Human Over-expression Lysate
LC423138 20 µg

RPS12 (NM_001016) Human Over-expression Lysate

Sign In for Pricing
View Details