Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Meleagris gallopavo D (2) dopamine receptor

This Recombinant Meleagris gallopavo D (2) dopamine receptor spans the amino acid sequence from region 1-436.

Product Specifications

Product Name Alternative

D (2) dopamine receptor, Dopamine D2 receptor

UniProt

O73810

Expression Region

1-436

Origin

Meleagris gallopavo (Common turkey)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYNTGDRNWSEPVNESSADQKPQYNYYAVLLTLLIFVIVFGNVLVCMAVSREK ALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSRIHCDIFVTLDVMMCTASIL NLCAISIDRYTAAAMPMLYNTRYSSKRRVTVMIACVWVLSFAISSPILFGLNKADERECI IANPAFVVYSSVVSFYVPFIVTLLVYVQIYMVLRRRRKRHTKRSSHGLDSDTHAPLKDKC THPENVKLGTVIVKSNGSFQVNKRKCEAESHIKMEMEMMSSTSPPERTIVKAAAPSNHQL VVPVASSRSTLDSPGKVEKNGHAKENLHTAKVFEIQSMPNGKTRSTLLKAMNRRKLSQQK EKKATQMLAIVLGVFIICWLPFFITHILNMHCDCNIPPAMYSAFTWLGYVNSAVNPIIYT TFNIEFRKAFMKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-100 1x 100 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF647 conjugate, 0.1mg/mL
BNC471274-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details