Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Transmembrane protein 184C (tmem184c)

This Recombinant Xenopus tropicalis Transmembrane protein 184C (tmem184c) spans the amino acid sequence from region 1-443.

Product Specifications

Product Name Alternative

Transmembrane protein 184C, Transmembrane protein 34

UniProt

Q28CV2

Expression Region

1-443

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPCTCGNWRRWIRPLVVLLYIVGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPI SLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWIALKYPDIAIYVDTCRECYEAYVI YNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVV RPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPI QPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWKKVQDVATGLQDFIICVEMFLA AVAHHFSFTYKPYVQEAEEGSCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFN DDLEQNEHTSLLSSSTQDPISAASSIPPSPSGHYQGFGQTITPQTTPTATTMPEELYSAD SPEADLVADHSKVPDESCNHLDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-100 1x 100 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details