Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 7 (mthl7)

This Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 7 (mthl7) spans the amino acid sequence from region 23-491.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor Mth-like 7, Protein methuselah-like 7

UniProt

Q9VSE7

Expression Region

23-491

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DIPGCNYYDTVDISYIERQNDSYLYDDIEIPASLTGYYEFRQFGDGSITPIEKHLRACVC SVRPCIRICCPAKNFLANGKCDDGLKEELARFKPYIYFTYMDLQARVPLTDMAIIRDEFF DCDEMIYISDFNYFLEEVSIQIFNKCGLIVWFQDGKFWVTVDLFMEKQDYCLYRHNFDSD FPKSMWIIRHRCTSHISPGSLEILIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRF IQCLIMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTSLNRVDPNYRFL RYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSL ALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWI FNVIPYSARLHIFWEWVGIISEYFHSAFGIVLFVLLVLKRSTWTLMMDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-100 1x 100 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF740 conjugate, 0.1mg/mL
BNC741060-500 1x 500 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details