Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A)

This Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, 5-HT2A, Serotonin receptor 2A

UniProt

P50129

Expression Region

1-470

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,16,19-Kauranetriol 2-O-beta-D-allopyranoside
TN2674 1 mg

2,16,19-Kauranetriol 2-O-beta-D-allopyranoside

Sign In for Pricing
View Details
Calcipressin 1, ID (DSCR1, Regulator Of Calcineurin 1, DSCR1, Down Syndrome Critical Region Protein 1, Myocyte-enriched Calcineurin-interacting Protein 1, MCIP1, Adapt78, RCAN1, DSC1, CSP1) (MaxLight 650) discontinued
C0114-85-ML650 100 µL

Calcipressin 1, ID (DSCR1, Regulator Of Calcineurin 1, DSCR1, Down Syndrome Critical Region Protein 1, Myocyte-enriched Calcineurin-interacting Protein 1, MCIP1, Adapt78, RCAN1, DSC1, CSP1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit
MBS9931615-01 48 Well

Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit

Sign In for Pricing
View Details
Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit
MBS9931615-02 96 Well

Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit

Sign In for Pricing
View Details
Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit
MBS9931615-03 5x 96 Well

Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit

Sign In for Pricing
View Details
Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit
MBS9931615-04 10x 96 Well

Mouse Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit

Sign In for Pricing
View Details