Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A)

This Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, 5-HT2A, Serotonin receptor 2A

UniProt

P50129

Expression Region

1-470

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit
MBS9319881-01 48 Well

Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit
MBS9319881-02 96 Well

Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit
MBS9319881-03 5x 96 Well

Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit
MBS9319881-04 10x 96 Well

Human Transmembrane emp24 domain-containing protein 7, TMED7 ELISA Kit

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 3, CT (GRM3, GPRC1C, MGLUR3, Metabotropic glutamate receptor 3) (MaxLight 405) discontinued
038375-ML405 100 µL

Metabotropic Glutamate Receptor 3, CT (GRM3, GPRC1C, MGLUR3, Metabotropic glutamate receptor 3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PROM1 Protein (C-Flag Tag, )
P512130 100 µg

PROM1 Protein (C-Flag Tag, )

Sign In for Pricing
View Details