Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A)

This Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, 5-HT2A, Serotonin receptor 2A

UniProt

P50129

Expression Region

1-470

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP4A11 (4A22), CT (20-hydroxyeicosatetraenoic Acid Synthase, 20-HETE Synthase, Cytochrome P450-HL-omega, CYP4AII, Lauric Acid omega-hydroxylase, Cytochrome P-450 HK omega, Fatty Acid omega-hydroxylase, CYPIVA11, Cytochrome P450 4A11, CYP4A11, CYP4A2) (MaxLight 750) discontinued
C9095-15E1-ML750 100 µL

CYP4A11 (4A22), CT (20-hydroxyeicosatetraenoic Acid Synthase, 20-HETE Synthase, Cytochrome P450-HL-omega, CYP4AII, Lauric Acid omega-hydroxylase, Cytochrome P-450 HK omega, Fatty Acid omega-hydroxylase, CYPIVA11, Cytochrome P450 4A11, CYP4A11, CYP4A2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Turkey enteric coronavirus Membrane protein (M)
MBS7040883-01 0.02 mg

Recombinant Turkey enteric coronavirus Membrane protein (M)

Sign In for Pricing
View Details
Recombinant Turkey enteric coronavirus Membrane protein (M)
MBS7040883-02 0.1 mg

Recombinant Turkey enteric coronavirus Membrane protein (M)

Sign In for Pricing
View Details
Recombinant Turkey enteric coronavirus Membrane protein (M)
MBS7040883-03 5x 0.1 mg

Recombinant Turkey enteric coronavirus Membrane protein (M)

Sign In for Pricing
View Details
COMMD1 Protein Vector (Human) (pPM-C-His)
PV010200 500 ng

COMMD1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-CSFV Viroporin p7 Antibody (1A037)
MVV28102 100 μg

Anti-CSFV Viroporin p7 Antibody (1A037)

Sign In for Pricing
View Details