Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heliothis virescens Octopamine receptor

This Recombinant Heliothis virescens Octopamine receptor spans the amino acid sequence from region 1-477.

Product Specifications

Product Name Alternative

Octopamine receptor

UniProt

Q25188

Expression Region

1-477

Origin

Heliothis virescens (Tobacco budworm moth)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQAATHVDANYTLINYTEEVIEDDRDACAVADDPKYPSSFGITLAVPEWEAICTAIVLT LIIISTIVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQWVF GIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLLMIGVVWVLS LIISSPPLLGWNDWPDVFEPDTPCRLTSQPGFVIFSSSGSFYIPLVIMTVVYFEIYLATK KRLRDRAKATKISTISSGQNKYNNKDDHHDQDSVSSEANHNEHQGVTRLVSDNEKKKRTR KLTPKKKPKRKYWSKDDKSQNKLIIPILSNENSVTDMGENLENRNTSSESNSKETHEDDL IEVNETVPVKTHHKKPKPNQQSAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPF FVIYLVIPFCASCCLSNKFINFITWLGYCNSALNPLIYTIFNMDFRRAFKKLLCMKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Ligase 1 (1A9), CF488A conjugate, 0.1mg/mL
BNC882177-500 1x 500 µL

DNA Ligase 1 (1A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZKSCAN3 Human Gene Knockout Kit (CRISPR)
KN202971BN 1 Kit

ZKSCAN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
beta Catenin (CTNNB1) (NM_001098209) Human Over-expression Lysate
LC426005 20 µg

beta Catenin (CTNNB1) (NM_001098209) Human Over-expression Lysate

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_001135700) Human Recombinant Protein
TP326999M 100 µg

14-3-3 zeta (YWHAZ) (NM_001135700) Human Recombinant Protein

Sign In for Pricing
View Details
VIP Mouse Monoclonal Antibody [Clone ID: OTI1E8]
CF806850 100 µg

VIP Mouse Monoclonal Antibody [Clone ID: OTI1E8]

Sign In for Pricing
View Details
Human Autophagy Related Protein 12 (ATG12) ELISA Kit
RDR-ATG12-Hu-01 96 Tests

Human Autophagy Related Protein 12 (ATG12) ELISA Kit

Sign In for Pricing
View Details