Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein JTB (Jtb)

This Recombinant Rat Protein JTB (Jtb) spans the amino acid sequence from region 31-146.

Product Specifications

Product Name Alternative

Protein JTB

UniProt

O88823

Expression Region

31-146

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EAPVREEKLSVSTSTSPCWLVEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGIVVGVALVFACLVIIRQRQLDRKALEKVRKQIESI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP94 Antibody
8C0218-AAT 50 µg

GRP94 Antibody

Sign In for Pricing
View Details
RBJ (DNAJC27) Mouse Monoclonal Antibody [Clone ID: OTI8A10]
CF811069 100 µg

RBJ (DNAJC27) Mouse Monoclonal Antibody [Clone ID: OTI8A10]

Sign In for Pricing
View Details
Uncoated Rat REN (Renin) ELISA Kit
E-UNEL-R0085-01 5x 96 Tests

Uncoated Rat REN (Renin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat REN (Renin) ELISA Kit
E-UNEL-R0085-02 15x 96 Tests

Uncoated Rat REN (Renin) ELISA Kit

Sign In for Pricing
View Details
ERGIC1 (NM_001031711) Human Over-expression Lysate
LY422162 100 µg

ERGIC1 (NM_001031711) Human Over-expression Lysate

Sign In for Pricing
View Details
Salidroside
TRC-S088600-50MG 50 mg

Salidroside

Sign In for Pricing
View Details