Recombinant Rat Protein JTB (Jtb)
This Recombinant Rat Protein JTB (Jtb) spans the amino acid sequence from region 31-146.
Product Specifications
Product Name Alternative
Protein JTB
UniProt
O88823
Expression Region
31-146
Origin
Rattus norvegicus (Rat)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
EAPVREEKLSVSTSTSPCWLVEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGIVVGVALVFACLVIIRQRQLDRKALEKVRKQIESI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH030407 50 µg
Recombinant Human Bruton Tyrosine Kinase/BTK Kinase Protein (His Tag)
Sign In for Pricing
View Details 
GA116602 1 Kit
Human Carboxylesterase 7 (CES5A) activation kit by CRISPRa
Sign In for Pricing
View Details 
TRC-T205165-500MG 500 mg
(S)-5-Tert-butoxy-4-(3-((s)-1,5-di-tert-butoxy-1,5-dioxopentan-2-yl)ureido)-5-oxopentanoic Acid
Sign In for Pricing
View Details 