Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila ATP synthase subunit b (atpF)

This Recombinant Legionella pneumophila ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5III7

Expression Region

1-156

Origin

Legionella pneumophila (strain Corby)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDINLTLIVQMLVFAAFVLFTMKLVWPPLAKALEERQDKIADGLAAAERGRKELELAQHRVKDELKQAKAHSADIIDKANKRASEIIEAAKEAAKREAQIQAKLAQEQIAQQVNHAKEELRKQVAKLAITGAEKILMREVDAKANSELLDNLIEEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/983), CF405S conjugate, 0.1mg/mL
BNC040983-500 1x 500 µL

CD117 (KIT/983), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL
BNC942026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF405S conjugate, 0.1mg/mL
BNC040870-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF647 conjugate, 0.1mg/mL
BNC472050-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF640R conjugate, 0.1mg/mL
BNC400870-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details