Recombinant Rat FXYD domain-containing ion transport regulator 5 (Fxyd5)
This Recombinant Rat FXYD domain-containing ion transport regulator 5 (Fxyd5) spans the amino acid sequence from region 22-178.
Product Specifications
Product Name Alternative
FXYD domain-containing ion transport regulator 5
UniProt
P59647
Expression Region
22-178
Origin
Rattus norvegicus (Rat)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
QTPEKPRSSFTAHQSSVTTHVPVPDQTSPGVQTTPPIWTSEAGEATGSQTAAKTKTQQLTEMATANPVTDPGPLTSSEKGTPALSRIKSPSPPKGYMPPSYIENPLDPNENSPFYYDNTTLRKRGLLVAAVLFITGIIILTSGKCRQFSQLCLNRHR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940029-100 1x 100 µL
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402848-100 1x 100 µL
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740043-100 1x 100 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details