Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Group XVI phospholipase A1/A2 (Pla2g16)

This Recombinant Rat Group XVI phospholipase A1/A2 (Pla2g16) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Group XVI phospholipase A1/A2, EC= 3.1.1.32, EC= 3.1.1.4, H-rev 107 protein, HRAS-like suppressor 3

UniProt

P53817

Expression Region

1-160

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKKELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PCDHGC4
Y058739 100 µg

Anti-PCDHGC4

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-100 1x 100 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CRCP activation kit by CRISPRa
GA109107 1 Kit

Human CRCP activation kit by CRISPRa

Sign In for Pricing
View Details
Beta-Caryophyllinic Acid
TRC-C184740-1MG 1 mg

Beta-Caryophyllinic Acid

Sign In for Pricing
View Details
TOX3 (TOX3/1123), CF405S conjugate, 0.1mg/mL
BNC041123-500 1x 500 µL

TOX3 (TOX3/1123), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS801638 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details