Recombinant Dog Signal peptidase complex catalytic subunit SEC11A (SEC11A)
This Recombinant Dog Signal peptidase complex catalytic subunit SEC11A (SEC11A) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
Signal peptidase complex catalytic subunit SEC11A, EC= 3.4.21.89, Endopeptidase SP18, Microsomal signal peptidase 18 kDa subunit, SPase 18 kDa subunit, SEC11 homolog A, SEC11-like protein 1, SPC18
UniProt
P67811
Expression Region
1-179
Origin
Canis familiaris (Dog) (Canis lupus familiaris)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog