Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease hepsin (Hpn)

This Recombinant Mouse Serine protease hepsin (Hpn) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Serine protease hepsin, EC= 3.4.21.106, Cleaved into the following 2 chains:, 1. Serine protease hepsin non-catalytic chain, 2. Serine protease hepsin catalytic chain

UniProt

O35453

Expression Region

1-181

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKEDEEPGAHRGGSTCSRPQPGKGGRTAACCSRPKVAALIVGTLLFLTGIGAASWAIVTILLQSDQEPLYQVQLSPGDSRLAVFDKTEGTWRLLCSSRSNARVAGLGCEEMGFLRALAHSELDVRTAGANGTSGFFCVDEGGLPLAQRLLDVISVCDCPRGRFLTATCQDCGRRKLPVDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COL1A1 Protein Lysate
MBS139725-01 0.02 mg

Human COL1A1 Protein Lysate

Sign In for Pricing
View Details
Human COL1A1 Protein Lysate
MBS139725-02 5x 0.02 mg

Human COL1A1 Protein Lysate

Sign In for Pricing
View Details
SHPK antibody
MBS5303301-01 0.05 mL

SHPK antibody

Sign In for Pricing
View Details
SHPK antibody
MBS5303301-02 5x 0.05 mL

SHPK antibody

Sign In for Pricing
View Details
Recombinant Human Thyrostimulin Alpha
7-02232 1 mg

Recombinant Human Thyrostimulin Alpha

Sign In for Pricing
View Details
Rabbit Monoclonal Serpin F1/PEDF Antibody (4H0C5)
NBP3-16195-100ul 100 µL

Rabbit Monoclonal Serpin F1/PEDF Antibody (4H0C5)

Sign In for Pricing
View Details