Recombinant Rat T-cell surface glycoprotein CD8 beta chain (Cd8b)
This Recombinant Rat T-cell surface glycoprotein CD8 beta chain (Cd8b) spans the amino acid sequence from region 22-208.
Product Specifications
Product Name Alternative
T-cell surface glycoprotein CD8 beta chain, CD8 antigen 37 kDa chain, OX-8 membrane antigen, CD_antigen= CD8b
UniProt
P05541
Expression Region
22-208
Origin
Rattus norvegicus (Rat)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
LLQTPSSLLVQTNQTAKMSCEAKTFPKGTTIYWLRELQDSNKNKHFEFLASRTSTKGIKYGERVKKNMTLSFNSTLPFLKIMDVKPEDSGFYFCAMVGSPMVVFGTGTKLTVVDVLPTTAPTKKTTLKKKQCPTPHPKTQKGLTCGLITLSLLVACILVLLVSLSVAIHFHCMRRRARIHFMKQFHK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743056-100 1x 100 µL
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1937-100 1x 100 µL
Vimentin (Mesenchymal Cell Marker) (VIM/1937R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 