Recombinant Human Ephrin-B1 (EFNB1)
This Recombinant Human Ephrin-B1 (EFNB1) spans the amino acid sequence from region 28-346.
Product Specifications
Product Name Alternative
Ephrin-B1, EFL-3, ELK ligand, ELK-L, EPH-related receptor tyrosine kinase ligand 2, LERK-2
UniProt
P98172
Expression Region
28-346
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
030776 100 µL
APCS (APCS, PTX2, Serum amyloid P-component, 9.5S alpha-1-glycoprotein, Serum amyloid P-component (1-203) )
Sign In for Pricing
View Details 
orb2573600 200 µL
Fruit fly CG17352 target 2 Culd Rabbit Polyclonal Antibody (APC)
Sign In for Pricing
View Details 