Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synaptotagmin-1 (snt-1)

This Recombinant Synaptotagmin-1 (snt-1) spans the amino acid sequence from region 1-441.

Product Specifications

Product Name Alternative

Synaptotagmin-1, Synaptotagmin I

UniProt

P34693

Expression Region

1-441

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKLDFSSQDEENDEDLTKEFVRDEAPMEETTSEAVKQIATTTKETLKDVVVNKVIDVKDVVKEKVMQQTGMPEWAFVFLGFVFILLVLACAFCLIRKLFGKKRHGEKNKKGGLKGFFGKGQDVVDGKNIQGMAQDLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEGDKKDDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 1 (CLDN1) (Loop2) Rabbit Polyclonal Antibody
AP13331PU-N 400 µL

Claudin 1 (CLDN1) (Loop2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Chlorothiophene-2-boronic Acid (>80%)
TRC-C428053-250MG 250 mg

3-Chlorothiophene-2-boronic Acid (>80%)

Sign In for Pricing
View Details
FSD1 Rabbit Polyclonal Antibody
TA370123 100 µL

FSD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Monoclonal Antibody
E-AB-81457-01 50 µL

Recombinant alpha Smooth Muscle Actin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Monoclonal Antibody
E-AB-81457-02 100 µL

Recombinant alpha Smooth Muscle Actin Monoclonal Antibody

Sign In for Pricing
View Details
Transglutaminase 2 Antibody
8C0350-AAT 50 µg

Transglutaminase 2 Antibody

Sign In for Pricing
View Details