Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synaptotagmin-1 (snt-1)

This Recombinant Synaptotagmin-1 (snt-1) spans the amino acid sequence from region 1-441.

Product Specifications

Product Name Alternative

Synaptotagmin-1, Synaptotagmin I

UniProt

P34693

Expression Region

1-441

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKLDFSSQDEENDEDLTKEFVRDEAPMEETTSEAVKQIATTTKETLKDVVVNKVIDVKDVVKEKVMQQTGMPEWAFVFLGFVFILLVLACAFCLIRKLFGKKRHGEKNKKGGLKGFFGKGQDVVDGKNIQGMAQDLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEGDKKDDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastrin (GAST/2632), CF640R conjugate, 0.1mg/mL
BNC402632-100 1x 100 µL

Gastrin (GAST/2632), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Benzyldiethylamine-d4
TRC-B254532-2.5MG 2.5 mg

N-Benzyldiethylamine-d4

Sign In for Pricing
View Details
Apobec4 Mouse Gene Knockout Kit (CRISPR)
KN501414 1 Kit

Apobec4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TDP1 Recombinant Rabbit Monoclonal Antibody [PSH0-93]
HA721531 100 µL

TDP1 Recombinant Rabbit Monoclonal Antibody [PSH0-93]

Sign In for Pricing
View Details
LysoViewTM 633, 10 vials
#70058 1x 10 Each

LysoViewTM 633, 10 vials

Sign In for Pricing
View Details
PPP3CC Human Gene Knockout Kit (CRISPR)
KN402495 1 Kit

PPP3CC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details