Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synaptotagmin-1 (snt-1)

This Recombinant Synaptotagmin-1 (snt-1) spans the amino acid sequence from region 1-441.

Product Specifications

Product Name Alternative

Synaptotagmin-1, Synaptotagmin I

UniProt

P34693

Expression Region

1-441

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKLDFSSQDEENDEDLTKEFVRDEAPMEETTSEAVKQIATTTKETLKDVVVNKVIDVKDVVKEKVMQQTGMPEWAFVFLGFVFILLVLACAFCLIRKLFGKKRHGEKNKKGGLKGFFGKGQDVVDGKNIQGMAQDLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEGDKKDDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101UC-01 25 µg

FITC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
FITC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101UC-02 100 µg

FITC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629364 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF594 conjugate, 0.1mg/mL
BNC942226-500 1x 500 µL

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR137 antibody
FNab03594 100 µg

GPR137 antibody

Sign In for Pricing
View Details
PKC ε (Ab-729) Antibody
8B0802-AAT 50 µg

PKC ε (Ab-729) Antibody

Sign In for Pricing
View Details