Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Calnexin (CANX)

This Recombinant Dog Calnexin (CANX) spans the amino acid sequence from region 21-593.

Product Specifications

Product Name Alternative

Calnexin, pp90

UniProt

P24643

Expression Region

21-593

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HEGHDDDMIDIEDDLDDVIEEVEDSKSKPDTSAPTSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSIVNSGNLLNDMTPPVNPSREIEDPEDQKPEDWDERPKIPDPDAVKPDDWNEDAPAKIPDEEATKPDGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIVCGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYVLTVALPVFLVILFCCSGKKQSSPVEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTASQEEDDRKPKAEEDEILNRSPRNRKPRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit
RD-MCAM-Hu-01 96 Tests

Human Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit

Sign In for Pricing
View Details
Human Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit
RD-MCAM-Hu-02 48 Tests

Human Melanoma Cell Adhesion Molecule (MCAM) ELISA Kit

Sign In for Pricing
View Details
Ralgds Mouse Gene Knockout Kit (CRISPR)
KN514445 1 Kit

Ralgds Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARA9 (AIP) Human Gene Knockout Kit (CRISPR)
KN211157BN 1 Kit

ARA9 (AIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Krt36 activation kit by CRISPRa
GA202377 1 Kit

Mouse Krt36 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561946 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details