Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta Opsin-2 (OP2)

This Recombinant Manduca sexta Opsin-2 (OP2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Opsin-2, MANOP2, Rhodopsin 2, short-wavelength, Rhodopsin P357

UniProt

O02465

Expression Region

1-377

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNQSENYYHGAQFEALKSAGAIEMLGDGLTGDDLAAIPEHWLSYPAPPASAHTALALLY IFFTFAALVGNGMVIFIFSTTKSLRTSSNFLVLNLAILDFIMMAKAPIFIYNSAMRGFAV GTVGCQIFALMGAYSGIGAGMTNACIAYDRHSTITRPLDGRLSEGKVLLMVAFVWIYSTP WALLPLLKIWGRYVPEGYLTSCSFDYLTNTFDTKLFVACIFTCSYVFPMSLIIYFYSGIV KQVFAHEAALREQAKKMNVESLRANQGGSSESAEIRIAKAALTVCFLFVASWTPYGVMAL IGAFGNQQLLTPGVTMIPAVACKAVACISPWVYAIRHPMYRQELQRRMPWLQIDEPDDTV STATSNTTNSAPPAATA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2 3-Dichlorophenyl Isocyanate 97%
D16635 5 g

2 3-Dichlorophenyl Isocyanate 97%

Sign In for Pricing
View Details
Onjixanthone I
MBS5788019 Inquire

Onjixanthone I

Sign In for Pricing
View Details
TCL6 / TNG1 (C-term) Rabbit Polyclonal Antibody
AP54205PU-N 400 µL

TCL6 / TNG1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIP4K2C (NM_024779) Human Recombinant Protein
PH39098M5 20 µg

PIP4K2C (NM_024779) Human Recombinant Protein

Sign In for Pricing
View Details
3-Hydroxy Carbofuran-d3
TRC-H825042-1MG 1 mg

3-Hydroxy Carbofuran-d3

Sign In for Pricing
View Details
Lentiviral mouse Slc16a1 shRNA (UAS) - Lentiviral mouse Slc16a1 shRNA (UAS, iRFP) plasmid
GTR15205348 1 Vial

Lentiviral mouse Slc16a1 shRNA (UAS) - Lentiviral mouse Slc16a1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details