Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable low-affinity inorganic phosphate transporter (pit)

This Recombinant Probable low-affinity inorganic phosphate transporter (pit) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Probable low-affinity inorganic phosphate transporter

UniProt

O06411

Expression Region

1-417

Origin

Mycobacterium tuberculosis

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVAVALPAVLNLIGAFLS TAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGATIAA VGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRGVAEKRTERGFRRGQIGS ASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVIVSCAVAMAAGTYLGGWRI IRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVATGSVLGSGVGKPGAEVR WGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAILGFALLWLTATAIWLRSRRAP IDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPTPPPNHRAPQFGVTTRNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1264 (NM_001000456) Rat Untagged Clone
RN204604 10 µg

Olr1264 (NM_001000456) Rat Untagged Clone

Sign In for Pricing
View Details
Sept7 sgRNA CRISPR Lentivector set (Mouse)
K4697101 3x 1.0 µg

Sept7 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PMPCB (NM_004279) Human Tagged Lenti ORF Clone
RC215039L3 10 µg

PMPCB (NM_004279) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LIMA1 Over-expression Lysate Product
GWB-8FC3C4 0.1 mg

LIMA1 Over-expression Lysate Product

Sign In for Pricing
View Details
HFE Knockout Raji Polyclonal Cells
ARG23695 1 Million

HFE Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
SQSTM1 Human shRNA Plasmid Kit (Locus ID 8878)
TR309121 1 Kit

SQSTM1 Human shRNA Plasmid Kit (Locus ID 8878)

Sign In for Pricing
View Details