Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trypanosoma brucei brucei GPI mannosyltransferase 1 (PIGM)

This Recombinant Trypanosoma brucei brucei GPI mannosyltransferase 1 (PIGM) spans the amino acid sequence from region 1-430.

Product Specifications

Product Name Alternative

GPI mannosyltransferase 1, EC= 2.4.1.-, GPI mannosyltransferase I, GPI-MT-I, Phosphatidylinositol-glycan biosynthesis class M protein, PIG-M, TbPIG-M

UniProt

Q9BPQ5

Expression Region

1-430

Origin

Trypanosoma brucei brucei (strain 927/4 GUTat10.1)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELQSLIDTVSLQKLLLLGALLRLILIAYAFFHDQWFRVKYTDIDYMIVVDGARHMWNGG SPFDRTTFRYTPLLAALVMPSIWIANPMGKLIFASSDLGAAWYCYGVLKSFAKERSAKWM VSLFILFNPIVLSVSTRGNSDMLVTFMSLMVLSKFARRKCYQAAAVLGFAVHFKIYPIIY ALPLTLGVWEQSVAASTNTWRRVVKTAVVVSICALMAAISFAVPTVLCYMKYGQQYLNEA FIYHVYREDHRHNFSPYWLLMYLNMARRHLGQGVDFSPRLVAFAPQAVVLSFVSYKLRRN TAHACCVQTVLFVAFNKVCTVQYFVWFIPFLAFLFCEPKEVEDDESGGSGAFKFFSWVKA LGVVLMWAATIPLWVTTAVPLEFHGYSDFAQLWIVSCLFFLAMVVLASMLARIAYRVQCT KCSAKSIKVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-100 1x 100 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF488A conjugate, 0.1mg/mL
BNC881481-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (VWF635), CF405S conjugate, 0.1mg/mL
BNC040635-100 1x 100 µL

Von Willebrand Factor (VWF635), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details