Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Human Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-450.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2 adrenergic receptor subtype C2, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

P18089

Expression Region

1-450

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS LNPVIYTIFNQDFRRAFRRILCRPWTQTAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SCN3B shRNA (UAS) - Lentiviral human SCN3B shRNA (UAS, RFP) plasmid
GTR15334576 1 Vial

Lentiviral human SCN3B shRNA (UAS) - Lentiviral human SCN3B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rnf126 3'UTR Luciferase Stable Cell Line
TU117954 1.0 mL

Rnf126 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein B (APOB)
MBS2111397-01 0.1 mL

Polyclonal Antibody to Apolipoprotein B (APOB)

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein B (APOB)
MBS2111397-02 0.2 mL

Polyclonal Antibody to Apolipoprotein B (APOB)

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein B (APOB)
MBS2111397-03 0.5 mL

Polyclonal Antibody to Apolipoprotein B (APOB)

Sign In for Pricing
View Details
Polyclonal Antibody to Apolipoprotein B (APOB)
MBS2111397-04 1 mL

Polyclonal Antibody to Apolipoprotein B (APOB)

Sign In for Pricing
View Details