Recombinant Balaenoptera musculus ATP synthase protein 8 (MT-ATP8)
This Recombinant Balaenoptera musculus ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-63.
Product Specifications
Product Name Alternative
ATP synthase protein 8, A6L, F-ATPase subunit 8
UniProt
P41292
Expression Region
1-63
Origin
Balaenoptera musculus (Blue whale)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPQLDTSTWLLTILSMLLTLFVLFQLKISKHSYSPNPKLVPTKTQKQQTPWNITWTKIYLPLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682332-500 1x 500 µL
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402953-500 1x 500 µL
C1QA / Complement C1q A-Chain (C1QA/2953), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471175-100 1x 100 µL
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details