Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Amaranthus caudatus Antimicrobial peptide 2

Product Specifications

Product Name Alternative

(AMP2) (AMP1)

Abbreviation

Recombinant Amaranthus caudatus Antimicrobial peptide 2 protein

UniProt

P27275

Expression Region

26-55aa

Organism

Amaranthus caudatus (Love-lies-bleeding) (Inca-wheat)

Target Sequence

VGECVRGRCPSGMCCSQFGYCGKGPKYCGR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Required for assembly of the protein secretion apparatus HSI-I. Actively secreted during chronic infection of cystic fibrosis patients.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.9 kDa

References & Citations

"Cryo-EM structure of a type IV secretion system." Mace K., Vadakkepat A.K., Redzej A., Lukoyanova N., Oomen C., Braun N., Ukleja M., Lu F., Costa T.R.D., Orlova E.V., Baker D., Cong Q., Waksman G. Nature 607:191-196 (2022)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aph1b ORF Vector (Rat) (pORF)
ORF063502 1.0 µg DNA

Aph1b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Prokaryotic Mouse Protein Arginine Methyltransferase 1
RPU60116-01 50 µg

Prokaryotic Mouse Protein Arginine Methyltransferase 1

Sign In for Pricing
View Details
Prokaryotic Mouse Protein Arginine Methyltransferase 1
RPU60116-02 100 µg

Prokaryotic Mouse Protein Arginine Methyltransferase 1

Sign In for Pricing
View Details
Prokaryotic Mouse Protein Arginine Methyltransferase 1
RPU60116-03 1 mg

Prokaryotic Mouse Protein Arginine Methyltransferase 1

Sign In for Pricing
View Details
MuRF1 shRNA Plasmid (m)
sc-149717-SH 20 µg

MuRF1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Rat C-telopeptide of Collagen alpha-1(I) chain ELISA Kit
MBS2882666-01 48 Well

Rat C-telopeptide of Collagen alpha-1(I) chain ELISA Kit

Sign In for Pricing
View Details