Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Amaranthus caudatus Antimicrobial peptide 2

Product Specifications

Product Name Alternative

(AMP2) (AMP1)

Abbreviation

Recombinant Amaranthus caudatus Antimicrobial peptide 2 protein

UniProt

P27275

Expression Region

26-55aa

Organism

Amaranthus caudatus (Love-lies-bleeding) (Inca-wheat)

Target Sequence

VGECVRGRCPSGMCCSQFGYCGKGPKYCGR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Required for assembly of the protein secretion apparatus HSI-I. Actively secreted during chronic infection of cystic fibrosis patients.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.9 kDa

References & Citations

"Cryo-EM structure of a type IV secretion system." Mace K., Vadakkepat A.K., Redzej A., Lukoyanova N., Oomen C., Braun N., Ukleja M., Lu F., Costa T.R.D., Orlova E.V., Baker D., Cong Q., Waksman G. Nature 607:191-196 (2022)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF17 rabbit pAb
ES19174-01 50 µL

RNF17 rabbit pAb

Sign In for Pricing
View Details
RNF17 rabbit pAb
ES19174-02 100 µL

RNF17 rabbit pAb

Sign In for Pricing
View Details
CBLC (Signal Transduction Protein CBL-C, RING Finger Protein 57, SH3-binding Protein CBL-3, SH3-binding Protein CBL-C, CBL3, RNF57) (AP) discontinued
124387-AP 100 µL

CBLC (Signal Transduction Protein CBL-C, RING Finger Protein 57, SH3-binding Protein CBL-3, SH3-binding Protein CBL-C, CBL3, RNF57) (AP) discontinued

Sign In for Pricing
View Details
Anti-Human CPM Polyclonal Antibody
HC786014-01 50 µg

Anti-Human CPM Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CPM Polyclonal Antibody
HC786014-02 100 µg

Anti-Human CPM Polyclonal Antibody

Sign In for Pricing
View Details
Pgpep1 (NM_023217) Mouse Recombinant Protein
E45M48264M5 20 µg

Pgpep1 (NM_023217) Mouse Recombinant Protein

Sign In for Pricing
View Details