LASB, Pseudomonas aeruginosa (P. pastoris, His)

LASB proteins are multifunctional enzymes that exhibit broad substrate specificity by cleaving host elastin, collagen, IgG, multiple complement components, and endogenous proaminopeptidases. Furthermore, LASB exhibits autocatalytic activity in processing its own propeptide and plays a role in processing the propeptide of chitin-binding protein (cbpD). LASB Protein, Pseudomonas aeruginosa (P. pastoris, His) is the recombinant LASB protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of LASB Protein, Pseudomonas aeruginosa (P. pastoris, His) is 301 a.a., with molecular weight of 35.2 kDa.

AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL