Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIZ1, Human (His)

RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human (His) is the recombinant human-derived RIZ1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RIZ1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/riz1-protein-human-his.html

Purity

95.00

Smiles

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSA

Molecular Formula

7799 (Gene_ID) Q13029 (M1-A200) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)
MBS1476637-01 0.02 mg (E-Coli)

Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)

Ask
View Details
Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)
MBS1476637-02 0.02 mg (Yeast)

Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)

Ask
View Details
Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)
MBS1476637-03 0.1 mg (E-Coli)

Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)

Ask
View Details
Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)
MBS1476637-04 0.1 mg (Yeast)

Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)

Ask
View Details
Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)
MBS1476637-05 0.02 mg (Baculovirus)

Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)

Ask
View Details
Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)
MBS1476637-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Doublesex- and mab-3-related transcription factor 3 (Dmrt3)

Ask
View Details