Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6), Biotinylated

This Recombinant Human Interleukin-6 (IL6), Biotinylated spans the amino acid sequence from region 30-212aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 2 ; BSF-2; CTL differentiation factor ; CDFHybridoma growth factorInterferon beta-2 ; IFN-beta-2

UniProt

P05231

Expression Region

30-212aa

Tag

N-terminal hFc1-tagged and C-terminal Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF9 (NM_002010) Human Over-expression Lysate
LC419589 20 µg

FGF9 (NM_002010) Human Over-expression Lysate

Sign In for Pricing
View Details
MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein
TP320225 20 µg

MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF568 conjugate, 0.1mg/mL
BNC682222-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L1CAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]
TA500353BM 100 µL

L1CAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS702742 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
Ceftiofur Dioxime
TRC-C244720-1MG 1 mg

Ceftiofur Dioxime

Sign In for Pricing
View Details