Transthyretin 49-127 fragment Human, Recombinant
Transthyretin 49-127 fragment (0.1 mg) Human, Recombinant
Product Specifications
Source
Protein expressed in Escherichia coli.
Purity
95% by Chromatography and SDS-PAGE
Form
Lyophilized 0.1 mg/vial
Solubility
The lyophilized protein is readily soluble in PBS pH 7.4.
Molecular Weight
8767 Da
Storage Conditions
Room temperature, avoid light exposure.
Notes
For research use only.
AA Sequence
TSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742428-100 1x 100 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401139-100 1x 100 µL
CD66, pan (CEA) (Cocktail), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 