Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E4 (R251G) Human, Recombinant

Apolipoprotein E4 (R251G) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

>95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

34321.79 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIGLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamyl Prolyl tRNA synthetase (EPRS) (NM_004446) Human Tagged ORF Clone
RG217559 10 µg

Glutamyl Prolyl tRNA synthetase (EPRS) (NM_004446) Human Tagged ORF Clone

Sign In for Pricing
View Details
BNP-32 (Porcine) - I-125 Labeled Purified IgG
T-G-011-10 10 µCi

BNP-32 (Porcine) - I-125 Labeled Purified IgG

Sign In for Pricing
View Details
Mmu-miR-7686-3p miRNA Inhibitor
orb1869072-01 10 nmol

Mmu-miR-7686-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7686-3p miRNA Inhibitor
orb1869072-02 20 nmol

Mmu-miR-7686-3p miRNA Inhibitor

Sign In for Pricing
View Details
CLIP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0465605 3x 1.0 µg

CLIP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Hnrnpf (NM_001166431) Mouse Tagged Lenti ORF Clone
MR218542L4 10 µg

Hnrnpf (NM_001166431) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details